Protein Info for Psyr_1200 in Pseudomonas syringae pv. syringae B728a

Annotation: outer-membrane type III secretion protein HrcC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03958: Secretin_N" amino acids 109 to 167 (59 residues), 34.6 bits, see alignment 1.8e-12 amino acids 176 to 318 (143 residues), 51.1 bits, see alignment E=1.3e-17 TIGR02516: type III secretion outer membrane pore, YscC/HrcC family" amino acids 271 to 538 (268 residues), 260.2 bits, see alignment E=1.5e-81 PF00263: Secretin" amino acids 378 to 537 (160 residues), 118.1 bits, see alignment E=3.1e-38

Best Hits

Swiss-Prot: 98% identical to HRPH_PSESY: Hypersensitivity response secretion protein HrpH (hrpH) from Pseudomonas syringae pv. syringae

KEGG orthology group: K03219, type III secretion protein SctC (inferred from 100% identity to psb:Psyr_1200)

Predicted SEED Role

"Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX68 at UniProt or InterPro

Protein Sequence (700 amino acids)

>Psyr_1200 outer-membrane type III secretion protein HrcC (Pseudomonas syringae pv. syringae B728a)
MRKALMWLPLLLIGLSPATWAVTPEAWKHTAYAYDARQTELATALADFAKEFGMALDMPP
IPGVLDDRIRAQSPEEFLDRLGQEYHFQWFVYNDTLYVSPSSEHTSARIEVSSDAVDDLQ
TALTDVGLLDKRFGWGVLPNEGVVLVRGPAKYVELVRDYSKKVEAPEKGDKQDIIVFPLK
YASAADRTIRYRDQQLVVAGVASILQDLLDTRSRGGSINGMDLLGRGGRGNGLAGGGSPD
APSLPMSSSGLDTNALEQGLDQVLHYGGGGKSAGKSRSGGRANIRVTADVRNNAVLIYDL
PSRKAMYEKLIKELDVSRNLIEIDAVILDIDRNELAELSSRWNFNAGSVNGGANMFDAGT
SSTLFIQNAGKFAAELHALEGNGSASVIGNPSILTLENQPAVIDFSRTEYLTATSERVAN
IEPITAGTSLQVTPRSLDHDGKPQVQLIVDIEDGQIDISDINDTQPSVRKGNVSTQAVIA
EHGSLVIGGFHGLEANDKVHKVPLLGDIPYIGKLLFQSRSRELSQRERLFILTPRLIGDQ
VNPARYVQNGNPHDVDDQMKRIKERRDGGELPTRGDIQKVFTQMVDGAAPEGMHDGETLP
FETDSLCDPGQGLSLDGQRSQWYARKDWGVAVVVARNNTDKPVRIDESRCGGRWVIGVAA
WPHAWLQPGEESEVYIAVRQPQISKMAKESRPSLLRGAKP