Protein Info for Psyr_1195 in Pseudomonas syringae pv. syringae B728a

Annotation: type III secretion apparatus lipoprotein, YscJ/HrcJ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 219 to 242 (24 residues), see Phobius details TIGR02544: type III secretion apparatus lipoprotein, YscJ/HrcJ family" amino acids 7 to 199 (193 residues), 214.5 bits, see alignment E=5.7e-68 PF01514: YscJ_FliF" amino acids 22 to 181 (160 residues), 97.7 bits, see alignment E=3.8e-32

Best Hits

KEGG orthology group: K03222, type III secretion protein SctJ (inferred from 100% identity to psb:Psyr_1195)

Predicted SEED Role

"Type III secretion bridge between inner and outermembrane lipoprotein (YscJ,HrcJ,EscJ, PscJ)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX73 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Psyr_1195 type III secretion apparatus lipoprotein, YscJ/HrcJ family (Pseudomonas syringae pv. syringae B728a)
MKFLSAGLLLICMVLLGGCSDETDLFTGLSEQDSNEVVARLADQHIDARKRLEKTGVVVT
VATSDMNRAVRVLNAAGLPRQSRASLGDIFKKEGVISTPLEERARYIYALSQELEATLSQ
IDGVIVARVHVVLPERIAPGEPVQPASAAVFIKHSAALDPDSVRGRIQQMVASSIPGMST
QSAESKKFSIVFVPATEFQETTQWVSFGPFKLDSANLPFWNLMLWLVPVGLAVLLLIIAL
LLRSDWRASVLGRIGLAGRSRSTVPARA