Protein Info for Psyr_1193 in Pseudomonas syringae pv. syringae B728a

Annotation: type III helper protein HrpZ1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF04877: Harpin" amino acids 1 to 343 (343 residues), 415.9 bits, see alignment E=6.7e-129

Best Hits

Swiss-Prot: 95% identical to HRPZ_PSEAP: Harpin HrpZ (hrpZ) from Pseudomonas syringae pv. aptata

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1193)

Predicted SEED Role

"type III helper protein HrpZ(Pto)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX75 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Psyr_1193 type III helper protein HrpZ1 (Pseudomonas syringae pv. syringae B728a)
MQSLSLNSSSLQTPAMALVLVRPETETTGASSSSKALQEVVVKLAEELMRNGQLDDSSPL
GKLLAKSMAADGKAGGGIEDVIAALDKLIHEKLGDNFGASADNASGTGQQDLMTQVLNGL
AKSMLDDLLTKQDGGTSFSEDDMPMLNKIAQFMDDNPAQFPKPDSGSWVNELKEDNFLDG
DETAAFRSALDIIGQQLGNQQSGTGGLAGTGGGLGTPSSFSSNSSGVKGDPLIDANTGPG
DSGTTSGEAGQLIGELIDRGLQSVLAGGGLGTPVNTPQTGTAANGGQSAQDLDQLLGGLL
LKGLEATLKDAGQTATDVQSSAAQIATLLVSTLLQGTRNQAAA