Protein Info for Psyr_1182 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0187

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details PF25539: Bestrophin_2" amino acids 31 to 284 (254 residues), 215.8 bits, see alignment E=4.7e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1182)

Predicted SEED Role

"conserved effector locus protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX86 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Psyr_1182 Protein of unknown function UPF0187 (Pseudomonas syringae pv. syringae B728a)
MSGPFEKKWRCISRTVTYVGWSLFWLLLWDVAVTMDFMLIQGAGIDLPLMPLTLLCSALI
VLISFRNSSAYNRWWEARTLWGAMVNSSRSYGRQVLTLIEGSANERGNPVKEVLFNRHVA
YLRALRAHLKGDVSTAKLEGLLSHSEIQRARESNNFPNDIINGSAAMISEEFAGGRIDSI
RLARLESTMVELSNCQGGMERIANTPLPYPYVYFPRLFSTLFCIIMPLSMVTTLGWFTPA
ISTVVGCMLLAMDRIGTDLQAPFGASQHRIRMEDLCNTIEKNLRSMFDAPARQSLVIDSQ
DQQGSAWQPHRLVV