Protein Info for Psyr_1173 in Pseudomonas syringae pv. syringae B728a

Annotation: Lysine exporter protein (LYSE/YGGA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 204 (188 residues), 88.1 bits, see alignment E=2.8e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1173)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX95 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Psyr_1173 Lysine exporter protein (LYSE/YGGA) (Pseudomonas syringae pv. syringae B728a)
MLDLTQVLTYSAALGIAAAIPGPGMAALVARSVSGGAVSGFCLLSGLILGDLTYLSFAVF
GLAMIAEHFNALFQVVRWGAAIYLCYLAWQFWFADHQAIEIGKSAKKKELLSAAASGLTI
TLGNPKTIAFYLALLPLVINLETVSLQTWGLVLVPLTVLVLLAVGAVFIFAALRIRHLLS
SERAQRKLFRGAAAIMVAAAASMLVR