Protein Info for Psyr_1167 in Pseudomonas syringae pv. syringae B728a

Annotation: nucleoside ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 15 to 286 (272 residues), 102.1 bits, see alignment E=1.6e-33

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to psb:Psyr_1167)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXA1 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Psyr_1167 nucleoside ABC transporter membrane protein (Pseudomonas syringae pv. syringae B728a)
MADIDLTTFLLALLAGAIRVGTPFLFVSLGECLTEKSGRINLGLEGILVAGAMSGYAVAC
LSGSAWLGVGAAAGVGILLGLLHGLACSLPRVNDIAFGIALILLGTGLAFFLGKAFIQPQ
APMLPSLALGAWSSEERVRSALNINVLFFVGAALAFVLHWGLRTTRWGLMLRLVGDHAET
AQALGYRPLKVRIVATAVGGGLAGIGGAYLSLYYPGSWNEGLSSGQGLMAVALVIFARWR
PLACLWASLLFGAAGAIGPALQAVGISTGYYLFAAAPYALTLVVMYATCRRGRTLNGAPG
ELSLTR