Protein Info for Psyr_1152 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, ArsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 PF01022: HTH_5" amino acids 45 to 74 (30 residues), 24.4 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 52% identical to YBZH_BACSU: Uncharacterized HTH-type transcriptional regulator YbzH (ybzH) from Bacillus subtilis (strain 168)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to psb:Psyr_1152)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXB6 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Psyr_1152 transcriptional regulator, ArsR family (Pseudomonas syringae pv. syringae B728a)
MLSSMILEQIKAVGNDTRMLIMEWLKNPQAHFPPQDHGDPAIGVCVSHIQAKANLSASTA
SAHLAILQRAGLVQATRIGKWTYFRRDEQAIDRFADRLKKEL