Protein Info for Psyr_1145 in Pseudomonas syringae pv. syringae B728a

Annotation: Protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 60 (25 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 4 to 282 (279 residues), 303.3 bits, see alignment E=1.1e-94 PF01040: UbiA" amino acids 19 to 268 (250 residues), 201.4 bits, see alignment E=7.9e-64

Best Hits

Swiss-Prot: 100% identical to CYOE_PSEU2: Protoheme IX farnesyltransferase (cyoE) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to psb:Psyr_1145)

MetaCyc: 69% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXC3 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Psyr_1145 Protoheme IX farnesyltransferase (Pseudomonas syringae pv. syringae B728a)
MSLKHFIQITKPGIIFGNVLSVAGGFFLASKGNIDFGVFLAAVIGTSLVVASGCVFNNCI
DRDIDQRMERTRNRVLVQGLVSLKLALLYATLLGIAGVGLLYTEANPLAALFAVIGFVIY
VGLYSLYLKRRSVHGTLVGSLSGAMPPVIGYCAVSNSFDFAALTLLVMFSLWQMPHSYAI
AIFRFNDYRAAKIPVLPVKRGILVTKRHIMLYILAFLVATLMLTVGGYAGLNYLAVAAGM
GMYWLYMAWKGYKAVDDTVWARKLFVFSIFTITALSVMMSVDFQVTKELLVTYAF