Protein Info for Psyr_1141 in Pseudomonas syringae pv. syringae B728a

Annotation: cytochrome bo3 quinol oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 67 (26 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 14 to 238 (225 residues), 367.4 bits, see alignment E=1.2e-114 PF00116: COX2" amino acids 149 to 218 (70 residues), 24.7 bits, see alignment E=1.9e-09 PF06481: COX_ARM" amino acids 238 to 281 (44 residues), 64.9 bits, see alignment 4.6e-22

Best Hits

Swiss-Prot: 73% identical to CYOA_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas putida

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 99% identity to psp:PSPPH_1210)

MetaCyc: 73% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXC7 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Psyr_1141 cytochrome bo3 quinol oxidase subunit 2 (Pseudomonas syringae pv. syringae B728a)
MSKKRYPRFFGFLALFCMLLLSGCDGVPLLDPKGQVGIEQRNLIVIATLLMLIVVIPVIL
MTLIFAWKYRASNKAAKYTPDWSHSTKIEIAVWGVPMLLLVFLGYITYVSTHSLDPYRPL
DSDVKPVTIQAISVDWKWVFIYPDYGIATVNKIVFPAKTPINFQVTSDSVMNSFFIPGLG
GQIYAMAGMHTKLHLIANENHEFNGISANYSGAGFTGMKFKAIATSQADFDSWVSEVKSS
PKKLGTAEYAELIKPSERNPVELFSSVTPNLFQIVIDKYEGMNPGKKVVAGEKEVAGEAG
AEKGKNSAAGAEE