Protein Info for Psyr_1129 in Pseudomonas syringae pv. syringae B728a

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 371 (331 residues), 245.3 bits, see alignment E=3.8e-77 PF25973: BSH_CzcB" amino acids 66 to 207 (142 residues), 37.5 bits, see alignment E=4.5e-13 PF25917: BSH_RND" amino acids 67 to 203 (137 residues), 60.4 bits, see alignment E=3.2e-20 PF25876: HH_MFP_RND" amino acids 106 to 175 (70 residues), 65.5 bits, see alignment E=1.1e-21 PF25944: Beta-barrel_RND" amino acids 212 to 298 (87 residues), 49.4 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 41% identical to MDTA_SALTY: Multidrug resistance protein MdtA (mdtA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1129)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXD9 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Psyr_1129 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a)
MRRKTLTVTAVVLVIACAAIAGWKLTRPAALPKNAAAAVPVKVITVSLEDVPRFVTGIGS
VLSLQSVVIRPQVDGVLTRVLVKEGQQVKAGDLLATLDDRSIRAALEQARAQLAQSKAQL
DVAQLDLKRYRQLTQDNGISRQTFDQQQAMVRQLEATAKGNEASINASQVQLSYTQIRSP
VTGRVGIRNVDEGNFLRVSDAAGLFSVTQIDPIAVEFSLPQQMLPTLQGLIAERNAATVK
AYQGDGAANGLLLGEGTLSLIDNQVSASTGTIRAKAQFKNPGEQLWPGQLVTVKIQTGIE
LNSLKVPPQVVQRGVDLHFVYRLTADNKVEVVPVKVLYQDSEQTLISGPRAGDVLVSDGQ
SRLRPGATVEVITAPAADVASAQVEPAR