Protein Info for Psyr_1120 in Pseudomonas syringae pv. syringae B728a

Annotation: glucose-6-phosphate 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR00871: glucose-6-phosphate dehydrogenase" amino acids 8 to 485 (478 residues), 577.5 bits, see alignment E=1.1e-177 PF00479: G6PD_N" amino acids 13 to 184 (172 residues), 173.6 bits, see alignment E=6.9e-55 PF02781: G6PD_C" amino acids 187 to 485 (299 residues), 405.3 bits, see alignment E=1.3e-125

Best Hits

Swiss-Prot: 78% identical to G6PD_PSEAE: Glucose-6-phosphate 1-dehydrogenase (zwf) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to psb:Psyr_1120)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.49

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXE8 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Psyr_1120 glucose-6-phosphate 1-dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MPLITVEPCTFALFGALGDLAVRKLFPALYQLDRAGLLHEDTKILALAREPGDEESHLAY
IEKSMRRFIPETELEPDNLSRFLARLSYLHVDFLKAEDYVALAERVGNAETLIAYFATPA
SVYGAICENLASVNLAERTRAVLEKPIGHDLASSRRVNDAVAQFFPENRVYRIDHYLGKD
TVQNLIALRFANSLFETQWNQNHISHVEITVAEKVGIEGRWGYFDQAGQLRDMIQNHLLQ
LLCLIAMDPPSDLSADSIRDEKVKVLKALAPFTPERLATQVVRGQYTSGYSEGKAVPGYL
EEENSNTQSDTETFVALRADIRNWRWSGTPFYLRTGKRMPQKLSQIVIHFKEPPHYIFAP
EQRLQISNRLIIRLQPDEGISLQVMTKDQGLDKGMQLRSGPLQLNFSDTYRSARVPDAYE
RLLLEVMRGNQNLFVRKDEIEYAWQWCDQLIAGWKKAGDAPKPYPAGTWGPMSSIALITR
DGRSWYGDM