Protein Info for Psyr_1119 in Pseudomonas syringae pv. syringae B728a

Annotation: Helix-turn-helix protein RpiR:Sugar isomerase (SIS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF01418: HTH_6" amino acids 6 to 80 (75 residues), 94.8 bits, see alignment E=2.4e-31 PF01380: SIS" amino acids 128 to 256 (129 residues), 72.5 bits, see alignment E=3e-24

Best Hits

Swiss-Prot: 91% identical to HEXR_PSEPK: HTH-type transcriptional regulator HexR (hexR) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to pst:PSPTO_1299)

Predicted SEED Role

"Phosphogluconate repressor HexR, RpiR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXE9 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Psyr_1119 Helix-turn-helix protein RpiR:Sugar isomerase (SIS) (Pseudomonas syringae pv. syringae B728a)
MDRVRNLLEQIQGRLDELNKAERKVAEVILLNPQMATRLSIAALAQAAKVSEPTVNRFCR
SFSVSGYPELKLQLAQSLASGAAYVSRAVEADDNPEAYTQKIFGSAIASLDSACQQLDPA
LISKSVDMLIQARQIHFFGLGASAPVALDAQHKFFRFNLAVTAHADVLMQRMIASVAHTG
ELFVIISYTGRTRELVEVARIARANGASVLGLTAAGSPLAQASTVSLNIPLPEDTDIYMP
MTSRIIQLTVLDVLATGMTLRRGVDFQPHLRKIKESLNDSRYPIEDQG