Protein Info for Psyr_1103 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF454

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 60 to 63 (4 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details PF04304: DUF454" amino acids 32 to 146 (115 residues), 120.5 bits, see alignment E=1.9e-39

Best Hits

KEGG orthology group: K09790, hypothetical protein (inferred from 100% identity to psb:Psyr_1103)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXG5 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psyr_1103 Protein of unknown function DUF454 (Pseudomonas syringae pv. syringae B728a)
MKKRPVLLSWPGSPNLPVETMTYKPPGSRLSRLLYGILAYTALGIGIVAIFVPGLPTTEF
ILLAAWAATRSSPRLNAWLENHRVFGPILYNWRNGRLVARKAKISATISMLVCAVVMLSL
IGHAWWLYLALTGMALGNLWIWSRPEPDKIER