Protein Info for Psyr_1100 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS/PAC sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 PF00989: PAS" amino acids 38 to 160 (123 residues), 25.1 bits, see alignment E=3.7e-09 amino acids 186 to 292 (107 residues), 44.2 bits, see alignment E=4.3e-15 PF13426: PAS_9" amino acids 48 to 162 (115 residues), 34.6 bits, see alignment E=4.9e-12 amino acids 194 to 294 (101 residues), 63.5 bits, see alignment E=5e-21 TIGR00229: PAS domain S-box protein" amino acids 186 to 302 (117 residues), 69 bits, see alignment E=2e-23 PF08448: PAS_4" amino acids 193 to 297 (105 residues), 48.8 bits, see alignment E=1.9e-16 PF00512: HisKA" amino acids 315 to 383 (69 residues), 76 bits, see alignment E=4.9e-25 PF02518: HATPase_c" amino acids 430 to 564 (135 residues), 75.7 bits, see alignment E=9.7e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1100)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXG8 at UniProt or InterPro

Protein Sequence (576 amino acids)

>Psyr_1100 PAS/PAC sensor signal transduction histidine kinase (Pseudomonas syringae pv. syringae B728a)
MPTSPVDRPLVDAQSRAEKIVESRRQKILLKTGALQDAIFNSAYFSSIATDEHGVIQIFN
VGAERMLGYHSEDVVDKITPADISDPAELIIRAAALSHELNTPITPGFEALVFKASRGIE
DIYELTYIRKDGSRLSAMVSVTSLRDSAETIIGYLLIGTDNTARKQEEEAQALLDQRLRD
QQFYTRSLIESNIDALMMTDPQGIISDVNKQMMALTGRTRDELIGAPCKNFFTDPASADA
AIKRVLSEHKVSDYELTVRAYDGTETVVSYNAATFHDRDRKLKGVFAAARDVTERKRFER
TLEEKNIELEHASHMKSEFLATMSHELRTPLNAVIGFSEALRDGMVGDMTDAQRRYIGDI
FNSGQHLLSLINDILDLSKVEAGMMTLELESVDLDELLSNSLLIVREQAALQHIQLKLET
EAEFGELELDRRKTKQIVYNLLANAVKFSEPGGWVTLAVRLVPASQAGLIDGDWPTYGFA
LASGDCEQFLELSVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTEL
HGGCVAVASVKDLGARFVVWLPIRSPESAEARWPRS