Protein Info for Psyr_1098 in Pseudomonas syringae pv. syringae B728a

Annotation: response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 PF00072: Response_reg" amino acids 8 to 119 (112 residues), 103.9 bits, see alignment E=2e-33 TIGR00229: PAS domain S-box protein" amino acids 150 to 271 (122 residues), 68.6 bits, see alignment E=5.6e-23 PF00989: PAS" amino acids 151 to 261 (111 residues), 41.5 bits, see alignment E=4.3e-14 PF13188: PAS_8" amino acids 151 to 193 (43 residues), 34.8 bits, see alignment 3.8e-12 PF08448: PAS_4" amino acids 158 to 266 (109 residues), 23.3 bits, see alignment E=2.2e-08 PF13426: PAS_9" amino acids 162 to 262 (101 residues), 37.8 bits, see alignment E=7e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 273 to 433 (161 residues), 111.2 bits, see alignment E=4.3e-36 PF00990: GGDEF" amino acids 275 to 429 (155 residues), 135.5 bits, see alignment E=5.1e-43 PF00563: EAL" amino acids 452 to 687 (236 residues), 249.6 bits, see alignment E=9.7e-78

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1098)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXH0 at UniProt or InterPro

Protein Sequence (705 amino acids)

>Psyr_1098 response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (Pseudomonas syringae pv. syringae B728a)
MTESAATILIIDDDVHVRDLLEVLLQNQGYRTLTAESGELALAMVKRQAPDLILLDIMMP
GMDGYEVASQLKAEKGTANIPIIMLSALDDQSSRLSGLEAGAEEYLNKPVDSAELWLRVR
NLLRLKAFGDYLKSHSLILEDQLQQRTIDLERFRTVMDASEDAIFLINRNTMSLIEFNRR
ACQLLGYTAEELSHKTPAELGETSMEQLEVVYDQIIAGKGPSEPLETQIRDKSGRDVEVE
IHRQAYRTGEDWVIVGIVRDITRRKESDQRLLTMAHYDTLTGLPNRDLFFTSLQMGMTQA
AISRWKLAALTVNIDGFKNINETWGHVLGDEVLLEVSRRLSNCLNASDTLGRVDGDQFAL
ILMLRPGQADTRQTLERIRNALRAPFRIEGQSLVMTASIGIALYPEDGEDSRELIRHAYT
AMNSARKIGPDNYRFYTPQMNADVSARLDLEAALREAVRNQAFEIVYQPKLDLNNDRICG
LEALLRWPRPGHPGVSPAVFVPVLESLGLIGEVGNWVVDSVCAQIARWQRSGLGSFQVAV
NISGQQISSSSLVADIRQALEKHNVAPQWLEVELTESSLMENTAHTIATLGALRANRVSI
SIDDFGTGYSSLAYLRRFPIDKLKIDIAFIREVTSNPQDAAIARAIIELAHSLDLQVIAE
GVETPEQLAFLRENHCDQIQGYLISKPLPLEELETFLCSPASRVG