Protein Info for Psyr_1085 in Pseudomonas syringae pv. syringae B728a

Annotation: 23S rRNA m(6)A-1618 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF05971: Methyltransf_10" amino acids 24 to 321 (298 residues), 442.9 bits, see alignment E=6.2e-137 PF05175: MTS" amino acids 125 to 216 (92 residues), 24.2 bits, see alignment E=2.3e-09

Best Hits

Swiss-Prot: 100% identical to RLMF_PSEU2: Ribosomal RNA large subunit methyltransferase F (rlmF) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K06970, ribosomal RNA large subunit methyltransferase F [EC: 2.1.1.181] (inferred from 100% identity to psb:Psyr_1085)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase F (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.51

Use Curated BLAST to search for 2.1.1.181 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXI1 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Psyr_1085 23S rRNA m(6)A-1618 methyltransferase (Pseudomonas syringae pv. syringae B728a)
MTDTRKPPRKKPQRPAKPAAPREKATLHPRNRHQGQYDFAKLIKSSPELAAFVILNPYGK
ESIDFANPQAVRVFNRALLKAFYGIAHWDIPADYLCPPIPGRADYLHFLADLLAEDNEGV
IPRGASIKALDIGTGANCIYPLLGHSDYGWQFVGSDIDSTAIAAATTIVKANGLSKAISV
RQQANRRQILLGLLDSSERFHVSLCNPPFHASLEEAQRGSQRKWRALGKADPKRKLPVLN
FGGQSQELWCDGGEIGFITQLIQESALLPSQVAWFSTLVSKASNLPPIHSALKKAGALEV
KVVEMGQGQKQSRFVAWTFLDKAQRAPG