Protein Info for Psyr_1078 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 112 to 129 (18 residues), see Phobius details PF01638: HxlR" amino acids 49 to 134 (86 residues), 73.3 bits, see alignment E=5.8e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1078)

Predicted SEED Role

"Transcriptional regulator, HxlR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXI8 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Psyr_1078 Protein of unknown function DUF24 (Pseudomonas syringae pv. syringae B728a)
MPVDIQKVGTSVIPGGLDAQEVVRRSEAACAALSDDEDGLKRDILGHAGNRWSLGVVHAL
GVSSPLRHAQLRRKLHGVTQRMLTHTLRQLEQDGLITRHDYREKPLRVEYSLTDLGMGLL
VQMIPLWTWVIENSEAFSAARNRYLDR