Protein Info for Psyr_1067 in Pseudomonas syringae pv. syringae B728a

Annotation: GTP cyclohydrolase subunit MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 2 to 149 (148 residues), 223.2 bits, E=5.9e-71
• PF01967: MoaC
  • amino acids 13 to 147 (135 residues), 193.6 bits, E=7.2e-62

Best Hits

Swiss-Prot: 100% identical to MOAC_PSEU2: Cyclic pyranopterin monophosphate synthase (moaC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to psb:Psyr_1067)

MetaCyc: 68% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

See Q4ZXJ9 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Psyr_1067 GTP cyclohydrolase subunit MoaC (Pseudomonas syringae pv. syringae B728a)
MLTHLDSQGRANMVDVTDKAVTSREAVAEAFVRMLPTTLQMIVSGGHPKGDVFAVARIAG
IQAAKKTSDLIPLCHPLMLTSIKVHLAAEGDDAVRITASCKLAGQTGVEMEALTAASVAA
LTIYDMCKAVDRGMVIESVRLLEKLGGKSGHFIADQAQVSS