Protein Info for Psyr_1057 in Pseudomonas syringae pv. syringae B728a

Annotation: alginate biosynthesis protein AlgX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF16822: ALGX" amino acids 65 to 325 (261 residues), 235.1 bits, see alignment E=1.2e-73 PF16824: CBM_26" amino acids 346 to 470 (125 residues), 217.8 bits, see alignment E=3.7e-69

Best Hits

Swiss-Prot: 98% identical to ALGX_PSESM: Alginate biosynthesis protein AlgX (algX) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to psp:PSPPH_1112)

Predicted SEED Role

"Alginate biosynthesis protein AlgX" in subsystem Alginate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXK9 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Psyr_1057 alginate biosynthesis protein AlgX (Pseudomonas syringae pv. syringae B728a)
MHAHLIKLLSLSSLTAALMAAAGVARADDSQAPTFKAEPCCSLCPAAHDAKNYTTRYQQN
FTTLVQAQGDWLFRTQEDLRTEFDTTPAGYRRMKELHDAFKSKGVELVVVYQPTRGLVDR
NKLFPAERDKFDYDKALKNYQAMLGRFSKMGYWVPDLSPLTNEQQAHDFYFRGDQHWTPY
GAQRTAKIVAETVKKVPGYSDIPKREFESHISGRMGKTGTLHNMAGQLCGTSYAIQYMDQ
FTTEPKGEAGDGDLFGDSGNPEITLVGTSHSGKNYNFAGFLQEYMGADVLNVAFPGGGLE
GSMLQYLGSEDFQKRPPKILIWEFSPLYRLDQETIYRQMMSLLDNGCEGKPAVMSASTTL
KPGTNEVLVNGKNGIKDIRNGSNQIDIKFDDTSVKVLQARLWYMNGRHEDLKIEKPETSD
TDGRFAFELREDEDWANQQLLALEIQGPEAGTAPQKVEAKVCKRNVFPSAATHTAQAGL