Protein Info for Psyr_1054 in Pseudomonas syringae pv. syringae B728a

Annotation: alginate biosynthesis protein AlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details PF16822: ALGX" amino acids 81 to 346 (266 residues), 322.6 bits, see alignment E=1.2e-100

Best Hits

Swiss-Prot: 95% identical to ALGJ_PSESM: Probable alginate O-acetylase AlgJ (algJ) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1054)

MetaCyc: 55% identical to AlgJ (Pseudomonas aeruginosa)
RXN-16462

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXL2 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Psyr_1054 alginate biosynthesis protein AlgJ (Pseudomonas syringae pv. syringae B728a)
MTRSLRILYIALFLGILLVLGIWSLRSFSTFSTSAETTVLNGKWTKAAETHYDDEFPIKR
LGTNLWAALDFKLFNEGRPGVVLGKDQWLYTDEEFDAVANGEQNEADNLAIIQGVRDALE
KQGTKLVLAIVPAKTRLYPEHIGNTKPASLHADLYQQFHAQVAKAGIFAPDLLAPLQAAK
QQGQVFLRTDTHWTPMGAEVAAQQLSAAIAQKTPLEGEPEQFVTQAKGTEAYKGDLTTFL
PLDPLFSNMLPKPDELQKRSTDPVAGEAAGGEALFADSDIPVGLVGTSYSANPNWNFVGA
LKEALRSDVVNYAEDGHGPILPMLKYLQTDAFKNTPPQVVIWEFPERYLPAHNDLGEFDP
KWIAELKKSRDTQENVALNAKQSESPNRAQN