Protein Info for Psyr_1053 in Pseudomonas syringae pv. syringae B728a

Annotation: alginate biosynthesis protein AlgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF11182: AlgF" amino acids 22 to 200 (179 residues), 268.3 bits, see alignment E=1.3e-84

Best Hits

Swiss-Prot: 93% identical to ALGF_PSESM: Alginate biosynthesis protein AlgF (algF) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1053)

MetaCyc: 63% identical to AlgF (Pseudomonas aeruginosa)
RXN-16462

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXL3 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Psyr_1053 alginate biosynthesis protein AlgF (Pseudomonas syringae pv. syringae B728a)
MTFNTTANRSAAKRLFKTCAMAAGLGLMSLQAFAGDSALYGPTAPKGSTFVRVYNASNAE
INATVGNTNLNEVAPLGSTAFSFMPQGDYTAKLGSQSLPVKLAGDHYYTIVNNASGKPQL
VEEPPFKNKQKSLVRVQNLSDKSLTLKTADGKTDVVKAVAAKGIGEREINPVKVSLALYD
GDKKVTDVKPVALERGEAAVLYITGSGSSLSPVWVKPPVATR