Protein Info for Psyr_1046 in Pseudomonas syringae pv. syringae B728a

Annotation: Fusaric acid resistance protein conserved region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 103 to 119 (17 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 389 to 411 (23 residues), see Phobius details amino acids 417 to 434 (18 residues), see Phobius details amino acids 445 to 464 (20 residues), see Phobius details amino acids 470 to 488 (19 residues), see Phobius details amino acids 494 to 513 (20 residues), see Phobius details amino acids 522 to 543 (22 residues), see Phobius details PF04632: FUSC" amino acids 27 to 711 (685 residues), 732.4 bits, see alignment E=9.2e-224 PF06081: ArAE_1" amino acids 31 to 115 (85 residues), 23.4 bits, see alignment E=8.7e-09 PF13515: FUSC_2" amino acids 41 to 169 (129 residues), 52.1 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1046)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXM0 at UniProt or InterPro

Protein Sequence (729 amino acids)

>Psyr_1046 Fusaric acid resistance protein conserved region (Pseudomonas syringae pv. syringae B728a)
MIAALQRITDLAWRRELHSWARSDGVTWVYIFKVLLAAFLTYWLALRLELPQPHTAMITV
FIVMQPQSGQVFAKSFYRLLGTLAGSAMMVLLMALFAQNPLPFLGSLALWVGLCSAGAAR
YRNFRAYGFVLAGYTAAMVGLPALAHPEGSFMSAVWRVLEITLGILCSTAISAAVLPQSS
SAAMRNALYLRFGGFARFVVNGLRGDISRAEFETGNVRFVAEAIGLEGLRSVTVFEDPHM
RRRNGRLNRLNSEFMTVTTRFNALHQLLERLRLEQADQVLTHIDPGLEHLAELLDGFADR
ALTNDDAALLVTRLESYRAQFPEQVRSLRAELERTLPSDAERLDFHTSFELLYRLLSELL
DYARTHASLADHSHEREQWKGSFVARTHWMTALAAGARATCVVGLMSLYWVLTAWPSGAS
MVLASAATVALSSTTHNPRRMSLQMAGGTLLGALSGFLETFFLFPHIDGFPLLCLLLTPV
FVLGAYLGSRPQWTGYGLGLLIFFSLGSVPDNLTVYDPYTFINNYIAMVIGMLICAAAGA
IILPPNSRWMWRRLEQALRNQVVFAISAPLKRLGSSFESQTRDLMHQAYGLAIGKPLVQR
ELLRWMFVVLEIGHAIIELRHEQAILPIHPAYAEYQPWRIALRVMGRALVRLFIQPDAIN
LQRCLLAVDQAIKRVQEADEPFASHFDTSVLRRVKSYLHFIRTSLLDPQSPLAAYSVART
ASGVVHAAA