Protein Info for Psyr_1021 in Pseudomonas syringae pv. syringae B728a
Annotation: Short-chain dehydrogenase/reductase SDR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to FOLM_KLEP7: Dihydromonapterin reductase (folM) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
KEGG orthology group: K13938, dihydromonapterin reductase / dihydrofolate reductase [EC: 1.5.1.- 1.5.1.3] (inferred from 100% identity to psb:Psyr_1021)Predicted SEED Role
"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis
MetaCyc Pathways
- folate transformations III (E. coli) (9/9 steps found)
- folate transformations II (plants) (10/11 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
- tetrahydrofolate biosynthesis I (3/3 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
- superpathway of chorismate metabolism (42/59 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Folate biosynthesis
- Methane metabolism
- One carbon pool by folate
- Tryptophan metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.5.1.-, 1.5.1.3
Use Curated BLAST to search for 1.5.1.- or 1.5.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZXP5 at UniProt or InterPro
Protein Sequence (236 amino acids)
>Psyr_1021 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a) MAISSAPILITGASQRVGLHCALRLLEHGQRVIISYRTEHESVTELRQAGAVAIHGDFSC EAGIMAFVELLKTQTSSLRAIVHNASEWLAETPGDEAGNFTRMFNVHMLAPYLINLHCES LLTASEVADIVHISDDVTRKGSSKHIAYCATKAGLESLTLSFAARFAPLVKVNGIAPALL MFQPKDDAAYRANALAKSALGIEPGAEVIYQSLRYLLDSTYVTGTTLTVNGGRHVK