Protein Info for Psyr_0996 in Pseudomonas syringae pv. syringae B728a

Annotation: Alpha/beta hydrolase fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR03611: pyrimidine utilization protein D" amino acids 1 to 258 (258 residues), 424.8 bits, see alignment E=5.6e-132 PF00561: Abhydrolase_1" amino acids 14 to 127 (114 residues), 57.3 bits, see alignment E=3.8e-19 amino acids 181 to 244 (64 residues), 30 bits, see alignment E=8.7e-11 PF12697: Abhydrolase_6" amino acids 16 to 244 (229 residues), 64.7 bits, see alignment E=3.9e-21 PF12146: Hydrolase_4" amino acids 16 to 237 (222 residues), 51 bits, see alignment E=2.5e-17 PF08386: Abhydrolase_4" amino acids 198 to 256 (59 residues), 23.6 bits, see alignment E=9.6e-09

Best Hits

Swiss-Prot: 100% identical to RUTD_PSEU2: Putative aminoacrylate hydrolase RutD (rutD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09023, protein RutD (inferred from 100% identity to psb:Psyr_0996)

Predicted SEED Role

"Possible hydrolase or acyltransferase RutD in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXS0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Psyr_0996 Alpha/beta hydrolase fold protein (Pseudomonas syringae pv. syringae B728a)
MFHEFHACQHADAPTLVLSSGLGGSGRYWADDLTLLTRDYHVLVYDHAGTGRSPAVLPAD
YSIRHMAIELLALLDSLDIQRCHFMGHALGGLVGLELALLRPELLHSQVLINAWSSPNPH
SARCFSVRKKLLLNSGPEAYVQAQALFLYPADWIAANGPRLADDEAHALAHFPDTDNLLR
RIHALETFDVSAELSRIHTPTLLIANRDDMLVPWQQSRHLANALPNATLVLLEYGGHASN
ITDPLPFQRALRAFLSTQP