Protein Info for Psyr_0986 in Pseudomonas syringae pv. syringae B728a

Annotation: 16S rRNA m(2)G 1207 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF08468: MTS_N" amino acids 5 to 153 (149 residues), 150.3 bits, see alignment E=1.2e-47 PF05175: MTS" amino acids 162 to 327 (166 residues), 192.5 bits, see alignment E=1.1e-60 PF06325: PrmA" amino acids 184 to 250 (67 residues), 23 bits, see alignment E=1.4e-08 PF00891: Methyltransf_2" amino acids 184 to 297 (114 residues), 25.6 bits, see alignment E=1.9e-09 PF13649: Methyltransf_25" amino acids 196 to 292 (97 residues), 32.2 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 100% identical to RSMC_PSEU2: Ribosomal RNA small subunit methyltransferase C (rsmC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to psb:Psyr_0986)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.172

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXT0 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Psyr_0986 16S rRNA m(2)G 1207 methyltransferase (Pseudomonas syringae pv. syringae B728a)
MDPRSEVLLRQAELFQGSLLLVGLPADDLLGKLPDARGWCWHAGDQAALDARFEGRVDFG
VEAPQTGFEAAVLFLPKARDLTDYLLNALASRLAGRELFLVGEKRGGIEAAAKQLSPFGR
ARKLDSARHCQLWQVTVEHAPQAVSLDSLARPYQIELQDGPLTVVSLPGVFSHGRLDRGS
ALLLENIDKLPSGNLLDFGCGAGVLGAAIKRRYPHNEVIMLDVDAFATASSRLTLAANGL
QAQVLTGDGIDAAPMGLNTILSNPPFHVGVHTDYMATENLLRKARQHLKSGGELRLVANN
FLRYQPLIEEHVGQCEVRAQGNGFKIYSAKRP