Protein Info for Psyr_0970 in Pseudomonas syringae pv. syringae B728a

Annotation: Phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF00156: Pribosyltran" amino acids 24 to 169 (146 residues), 77.1 bits, see alignment E=4.9e-26

Best Hits

Swiss-Prot: 32% identical to HPRT_STRMU: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 98% identity to pst:PSPTO_1131)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXU6 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Psyr_0970 Phosphoribosyltransferase (Pseudomonas syringae pv. syringae B728a)
MSADLEHIRQVMREADCLYTEAEVDAAIARVGAQINAELAERNPVVFCVMNGGLIFSGKL
LTHLNFPLEASYLHATRYRNETTGGDLFWKAKPEVSFMDRDVLIIDDILDEGHTLGAIID
FCKHAGARAVHTAVLIDKDHDRKARPDLKADYVGLPCIDRYIFGFGMDYKGYWRNAAGIY
AVKGM