Protein Info for Psyr_0968 in Pseudomonas syringae pv. syringae B728a

Annotation: Xanthine/uracil permease family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 40 to 56 (17 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 10 to 408 (399 residues), 369.1 bits, see alignment E=1.5e-114 PF00860: Xan_ur_permease" amino acids 13 to 379 (367 residues), 315.6 bits, see alignment E=2.1e-98

Best Hits

Swiss-Prot: 59% identical to URAA_PASMU: Probable uracil permease (uraA) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02824, uracil permease (inferred from 100% identity to psb:Psyr_0968)

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXU8 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Psyr_0968 Xanthine/uracil permease family (Pseudomonas syringae pv. syringae B728a)
MTQQEFNDPLWRTILSGAQMLFVAFGALVLMPLITGLDPNVALFTAGLGTLLFQIVTGRQ
VPVFLASSFAFITPIILAKGQFGLAATMGGVMAAGFVYTFLGLAVKIKGTGFIDRLLPPV
VIGPVIISIGLAMAPIAANMAMGKSGDGVQLIPYQTAMLISMPALLTTLIVAVFGKGIFR
LVPIISGVLVGFALSFYFGVVDTKKIADAAWLALPHFTAPEFNWQAILFIVPVALAPAIE
HIGGVIAVGSVTGRDYLKKPGLHRTLFGDGIATTAAGLFGGPPNTTYAEVTGAVMLTKNY
NPQIMIWASFFAITLAFIGKFGALLQSIPVPVMGGILCLLFGSIAAVGMNTLIRHKIDLA
EARNLVIVSVTLVFGIGGVLIGTGNGPNDFGLKGIALCAVTAIALNLILPGNDSWKNKQL
DDQLP