Protein Info for Psyr_0967 in Pseudomonas syringae pv. syringae B728a

Annotation: ferrochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00109: ferrochelatase" amino acids 3 to 332 (330 residues), 221.2 bits, see alignment E=1.2e-69 PF00762: Ferrochelatase" amino acids 4 to 335 (332 residues), 328.1 bits, see alignment E=4.9e-102

Best Hits

Swiss-Prot: 100% identical to HEMH_PSEU2: Ferrochelatase (hemH) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01772, ferrochelatase [EC: 4.99.1.1] (inferred from 100% identity to psb:Psyr_0967)

Predicted SEED Role

"Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.99.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXU9 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Psyr_0967 ferrochelatase (Pseudomonas syringae pv. syringae B728a)
MTDHALLLVNLGSPASTQVADVRSYLNQFLMDPYVIDLPWPVRRLLVSLILIKRPEQSAH
AYASIWWDEGSPLVVLSKRLQQAMKKEWSHGPVELAMRYGEPSIETVLTRLAEQGFKKVT
LAPLYPQFADSTVTTVIEEAKRVVRAKSLKMQFSVLQPFYDQPEYLSALVESVRPHLEQP
YDHLLLSFHGLPERHLHKLDPTGKHCLKDDCCMTAPAEVLATCYRAQCIQSAAAFAKRMG
IADGKWSVSFQSRLGRAKWIEPYTEAHLDELAAKGVKKLLVMCPAFVADCIETLEEIGDR
GAEQFKEAGGEELILIPCLNDDPNWAKELNRLCERAPLML