Protein Info for Psyr_0948 in Pseudomonas syringae pv. syringae B728a

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR01035: glutamyl-tRNA reductase" amino acids 4 to 414 (411 residues), 453 bits, see alignment E=5e-140 PF05201: GlutR_N" amino acids 6 to 154 (149 residues), 190.9 bits, see alignment E=1.7e-60 PF01488: Shikimate_DH" amino acids 170 to 304 (135 residues), 161.1 bits, see alignment E=2.5e-51 PF00745: GlutR_dimer" amino acids 318 to 415 (98 residues), 79.4 bits, see alignment E=3.3e-26

Best Hits

Swiss-Prot: 100% identical to HEM1_PSEU2: Glutamyl-tRNA reductase (hemA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 100% identity to psb:Psyr_0948)

MetaCyc: 51% identical to glutamyl-tRNA reductase (Escherichia coli K-12 substr. MG1655)
Glutamyl-tRNA reductase. [EC: 1.2.1.70]

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXW8 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Psyr_0948 glutamyl-tRNA reductase (Pseudomonas syringae pv. syringae B728a)
MAFLALGINHKTASVDVRERVAFTPEQLVEALQQLCQLTQSREAAILSTCNRSELYIEHE
HLGADSILAWLANYHHLSLEELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMK
SAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQR
SQALLIGAGETITLVARHLHDLGVKRIVVANRTLERASMLAAEFGAHAVLLSDIPAELVN
SDIVISSTASQLPILGKGAVESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYSVDD
LHEVVAENLKSRQGAALAAEQLVSVGAEDFMSRLRELAAVDVLRAYRQQSERLRDEELSK
AQRMLANGSNAEDVLIQLARGLTNKLLHAPSVQLKKLSAEGRVDALAMAQELFALGEGST
DKPPQ