Protein Info for Psyr_0947 in Pseudomonas syringae pv. syringae B728a

Annotation: TPR repeat protein:TPR repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 PF13432: TPR_16" amino acids 205 to 254 (50 residues), 16.2 bits, see alignment 1.2e-05 amino acids 243 to 299 (57 residues), 27.7 bits, see alignment 3.1e-09 amino acids 285 to 329 (45 residues), 20.2 bits, see alignment 6.5e-07 amino acids 340 to 405 (66 residues), 20 bits, see alignment E=7.7e-07 amino acids 409 to 474 (66 residues), 20.9 bits, see alignment E=4.2e-07 amino acids 481 to 539 (59 residues), 26.6 bits, see alignment 6.8e-09 PF14559: TPR_19" amino acids 215 to 271 (57 residues), 40.4 bits, see alignment 2.9e-13 amino acids 455 to 510 (56 residues), 29 bits, see alignment 1e-09 amino acids 488 to 543 (56 residues), 28.3 bits, see alignment 1.8e-09 PF13424: TPR_12" amino acids 439 to 504 (66 residues), 31.2 bits, see alignment E=2e-10 PF07719: TPR_2" amino acids 475 to 507 (33 residues), 25.7 bits, see alignment (E = 8.1e-09) PF13374: TPR_10" amino acids 477 to 503 (27 residues), 19.5 bits, see alignment (E = 7.5e-07) PF13181: TPR_8" amino acids 479 to 507 (29 residues), 15.2 bits, see alignment (E = 1.8e-05) PF13174: TPR_6" amino acids 480 to 507 (28 residues), 17.2 bits, see alignment (E = 6.1e-06)

Best Hits

Swiss-Prot: 71% identical to Y4667_PSEAE: TPR repeat-containing protein PA4667 (PA4667) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0947)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXW9 at UniProt or InterPro

Protein Sequence (556 amino acids)

>Psyr_0947 TPR repeat protein:TPR repeat protein (Pseudomonas syringae pv. syringae B728a)
MTPASSQPVPAQKDAPPAPEAKPQVYGSFTQDTLVSLLSAELAGQRNRFDIALDNYVTQA
IKTQDPGVSERAYQIAEYMGADQSALDTALIWARNAPGNLEAQRAAAIQLARAGRYDDSL
VYMERVLQGQGDTHFDFLALSAAETDPDTRNGLLKSFDRLLGKYPNNGQLIFGKALLLQQ
NGDSEQSLKLLEDNPPKEGEIAPILLHARLLQSMNRGKEAVPLLEKSIKKYPDDKRLRLT
YARMLVEQNRMEDAKVQFSALLQQYPDDDELRFSLALVCLEAKAWDEAAGYLEELIARGA
HVDSAHLNLGRIHEERDDPQSALNEYAQVGPGPDFLAAQLRQADILLSNGNGAEAAKRLS
EARAEEPDYAIQLYLIEAETLTSNDQLDRGWQVLNQALKQYPDDANLLYTRAMLAEKRND
LAQMEKDLRTIIKREPENAMALNALGYTLSDRTTRYSEARDLIEKAHKISPDDPAVLDSL
GWVNYRLGNLDDAERYLRQALERFPDHEVAAHLGEVLWAKGEQREAKKVWAKALEQQPDS
TVLRSTLRRLTGSETL