Protein Info for Psyr_0934 in Pseudomonas syringae pv. syringae B728a

Annotation: Type I secretion membrane fusion protein, HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 24 to 437 (414 residues), 382.2 bits, see alignment E=1.7e-118 PF25973: BSH_CzcB" amino acids 71 to 320 (250 residues), 30.3 bits, see alignment E=6.4e-11 PF25994: HH_AprE" amino acids 100 to 287 (188 residues), 142.4 bits, see alignment E=4e-45 PF26002: Beta-barrel_AprE" amino acids 329 to 416 (88 residues), 101.9 bits, see alignment E=3.4e-33

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to psb:Psyr_0934)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXY0 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Psyr_0934 Type I secretion membrane fusion protein, HlyD (Pseudomonas syringae pv. syringae B728a)
MSIKTISTLDTHADDMPTSDRGIRRIGVTIVLVTFGLFGTWAALAPLDNAVYGSGLVMVQ
SYRKTVQHLEGGIVKELLVRDGDTVHKGDPLIVLDDSQLRSQYESTRNQLISTQAREARL
RAERDELPSIPPLTITGTDSVRAKEAIAGEQQVFSTRKNSRLTEISVQRERIGQLKQQIS
GLRDMIRTKVSLEKSYSSEITELKDLLSQGFVDKQRLLEQERKLDMLKSEVADHESTITK
TQLQISETELQIIQLNKNFSSDVAKELSDVQAKVFDLQETANALQDRLSRVVIRAPEDGM
VLDMKVHTVGGVVSAGTPLLDIVPESSELVVEAHVAITDIDRISIGKLTDVHFSAFNSAT
TPVIEGEVTRISADRLKDDAGEPYYLVRVKLTEKGMKRLGDRKLQPGMPAEVLINAGERT
MLQYLLKPASNVFIKSMIEE