Protein Info for Psyr_0923 in Pseudomonas syringae pv. syringae B728a

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 166 to 197 (32 residues), see Phobius details amino acids 203 to 220 (18 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0923)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXZ1 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Psyr_0923 hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MTVVSTSDNRSQLLLGVLLIILSGIVAGAVLPLTQALAGFQDGDGILTSLISTQKLTWYF
WGQDRLLNVIPALASPFSDVDTNLRVQVFFRSMFAYLSPLGILIFFNRSPRFLLVAIAIT
NIIVLACLSQYGKFNFYVQHNTFGTSMVMLAFAYALTYSQLPKAAIMVIALFVCSVAYAT
NYALLTYAIPVIFLLGVLRWPDWKRYLSFFVINGLAILIARYHSQTFGVASTDFGMLISL
QGIIESLNSIYQNLNLGAFLIFLAMTAISYQVSAEKKFLELSAVVCVGLGIIVLLANTVW
LQMNLYNIRYFLTSELIIASVMGFVITRMLMLGQYKYALIIPGLGLIYCVFVSSRGFGAD
YDELVAAPWRSNSEAVAKRAVEEKAEVITGGFWDVWPALFETKHLQPDLPVYGAAFRGGV
LRDDFLATTKGKGEFTALCFFDTTELCVNEIVGNFGVTGDNQLVVKKAEPIVVGEKKLLK
MVLEVN