Protein Info for Psyr_0914 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF13579: Glyco_trans_4_4" amino acids 17 to 171 (155 residues), 64.3 bits, see alignment E=3.4e-21 PF13439: Glyco_transf_4" amino acids 17 to 173 (157 residues), 67.7 bits, see alignment E=2.6e-22 PF00534: Glycos_transf_1" amino acids 186 to 344 (159 residues), 121.2 bits, see alignment E=7e-39 PF13692: Glyco_trans_1_4" amino acids 196 to 332 (137 residues), 84.6 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: K12995, rhamnosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to psb:Psyr_0914)

Predicted SEED Role

"Glycosyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY00 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Psyr_0914 Glycosyl transferase, group 1 (Pseudomonas syringae pv. syringae B728a)
MIKVLHFFKTYYPDTTGGIEQVIFQLAQGCRAFDVESQVLTLSPSPSPTRLQVADHQVTR
VKENFNLASTGFSAKVFSQFREMAAEADLVHFHFPWPLMDLVHFATRHGRPTVLSYHSDI
IKQRTLLKLYSPLMNQFLQRMDRILVASPNYLQTSETLKPFADKTVVVPYGLDQSAYPVV
PAQKRSEWQQRVPGKFFLFVGVLRYYKGLHTLLSALEGVDYPVVILGGGPQEAELKEQAE
KLQLRNVLFLGRLDDEDKACLLQMCYALVFPSHLRSEAFGISLLEASMYGKPMISCEIGT
GTTYVNIDEETGLAVPPENPLALREAMRRLWEAPEQAARFGENALARFHKLFTAERMCAS
TVQVYHDLLK