Protein Info for Psyr_0908 in Pseudomonas syringae pv. syringae B728a

Annotation: FMN-dependent alpha-hydroxy acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF01070: FMN_dh" amino acids 13 to 375 (363 residues), 431.1 bits, see alignment E=1.6e-133

Best Hits

Swiss-Prot: 100% identical to LLDD_PSEU2: L-lactate dehydrogenase (lldD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 100% identity to psb:Psyr_0908)

MetaCyc: 72% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY06 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psyr_0908 FMN-dependent alpha-hydroxy acid dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MIISSASDYRAAAKRKLPRFLFDYIDGGAYAEHTLRANGSDLADISLRQRVLKNVDNVSL
ETRLFGESLAMPIILSPVGLSGMYARRGEVQVARAAANKRIPFCLSTVSVCSIEEVASQS
DQAIWFQLYVLKDRGFMKNALERAKAAGVTTLVFTVDMPTPGARYRDAHSGMSGPYAAPR
RILQAMTKPDWALNVGLLGRPHDLGNISRYLGKATTLEDYVGWLANNFDPSISWKDLEWI
REFWQGPMIIKGILDPQDARDALSFGADGIVVSNHGGRQLDGVLSTAKALPPIVQAVGSD
LTVLADSGIRSGLDVVRMLALGAKGVLLGRSMAYALGADGQRGVENMLDIFAREMHVAMT
LTGVTSIEQIDASILVKAVA