Protein Info for Psyr_0899 in Pseudomonas syringae pv. syringae B728a

Annotation: Tripartite ATP-independent periplasmic transporter, DctQ component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details PF04290: DctQ" amino acids 27 to 153 (127 residues), 88.5 bits, see alignment E=1.7e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0899)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY15 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Psyr_0899 Tripartite ATP-independent periplasmic transporter, DctQ component (Pseudomonas syringae pv. syringae B728a)
MKNTLLRINDTLYRVCIGIAGLSVLIMTLIIPWGIFARYILGSGSSWPEPTAILLMVVFT
FFGAAASYRAGAHMAVSMAVDRMPQQVRRVASVVVQILMAIVALFMIFKGFKLCATTWNQ
FVGELPFLRVGISYLPIPIGGLVTLVFVLERLFLGDQSHRAVMRFDVIEESEGAA