Protein Info for Psyr_0888 in Pseudomonas syringae pv. syringae B728a

Annotation: 3-phosphoshikimate 1-carboxyvinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF00275: EPSP_synthase" amino acids 15 to 409 (395 residues), 283.1 bits, see alignment E=1.7e-88 TIGR01356: 3-phosphoshikimate 1-carboxyvinyltransferase" amino acids 18 to 413 (396 residues), 339 bits, see alignment E=1.8e-105

Best Hits

Swiss-Prot: 100% identical to AROA_PSEU2: 3-phosphoshikimate 1-carboxyvinyltransferase (aroA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 100% identity to psb:Psyr_0888)

Predicted SEED Role

"5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.19

Use Curated BLAST to search for 2.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY26 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Psyr_0888 3-phosphoshikimate 1-carboxyvinyltransferase (Pseudomonas syringae pv. syringae B728a)
MRPQATLTVLPVERPLVGRVSPPGSKSITNRALLLAGLAKGTSRLTGALKSDDTRVMSEA
LRLMGVQVDEPDDSTFVVTSSGHWQAPQQALFLGNAGTATRFLTAALANFEGDFVVDGDE
YMRKRPIGPLVDALQRMGVEVSAPSGCPPVAIKGKGGLEAGRIEIDGNLSSQYVSALLMA
GACGKGPVEVALTGSEIGARGYLDLTLAAMRAFGAEVQAIGDAAWKVSATGYRATDFHIE
PDASAATYLWAAQALTEGAIDLGVASNAFTQPDALASQIIASFPNMPAVIDGSQMQDAIP
TLAVLAAFNRQPVRFVGIANLRVKECDRISALSNGLCAIAPGLAVEEGDDLIVTANPTLA
GTTVDALIDTHSDHRIAMCFALAGLKIAGIRILDPDCVAKTYPGYWDALASLGVSVQR