Protein Info for Psyr_0871 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR00229: PAS domain S-box protein" amino acids 16 to 141 (126 residues), 40.8 bits, see alignment E=1.1e-14 amino acids 151 to 263 (113 residues), 46.5 bits, see alignment E=2e-16 PF08448: PAS_4" amino acids 31 to 134 (104 residues), 34.3 bits, see alignment E=7.5e-12 amino acids 154 to 258 (105 residues), 37.3 bits, see alignment E=8.3e-13 PF13426: PAS_9" amino acids 32 to 134 (103 residues), 40.2 bits, see alignment E=1e-13 amino acids 159 to 248 (90 residues), 40.2 bits, see alignment E=1.1e-13 PF00989: PAS" amino acids 32 to 132 (101 residues), 34.8 bits, see alignment E=4.5e-12 amino acids 153 to 244 (92 residues), 23.4 bits, see alignment E=1.5e-08 PF08447: PAS_3" amino acids 42 to 127 (86 residues), 41.8 bits, see alignment E=3.2e-14 amino acids 165 to 250 (86 residues), 53.5 bits, see alignment E=7.4e-18 PF00015: MCPsignal" amino acids 274 to 431 (158 residues), 125.1 bits, see alignment E=8.3e-40

Best Hits

Swiss-Prot: 46% identical to BDLA_PSEAE: Biofilm dispersion protein BdlA (bdlA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to psb:Psyr_0871)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY43 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Psyr_0871 PAS (Pseudomonas syringae pv. syringae B728a)
MFNTRLKKELQAQKAELSMYRQMQKGMDAQMVCLTLDASYHIVHANDNLLSTLGYSLEQV
LGKDLDHLVPTYVKQLDCYRSLKVAVQKGESVIDRYRFLHADGRLIWIRALWQPVLDEQG
RLMTLQCYGSDITQIVETAAENSAFIQALLRSTAVIEFNLSGQVLTANDQFLRGMGYSLA
QIKGKHHSMFCDPAETSQASYREFWAMLNRGEFVAGRFKRIDSNGREVWLEATYNPVHDA
QGKLYKVVKFATMVTDQVAREEEVSQAASVAFEISQQTDVSAQRGADVVQNTVQTMRKIS
EEMQTASSGIEALGKQSLLINSIVQTIGGIAQQTNLLALNAAIEAARAGEQGRGFAVVAD
EVRQLAGRTSAATEEIVSVVQQNQTLADEAVRGMANSRTQAEQGLVLANEAGAVIVEIQE
GAKQVVGAVGRFANQLK