Protein Info for Psyr_0862 in Pseudomonas syringae pv. syringae B728a

Annotation: Acyltransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 149 to 165 (17 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 13 to 338 (326 residues), 115.7 bits, see alignment E=2.4e-37 PF19040: SGNH" amino acids 403 to 667 (265 residues), 151.1 bits, see alignment E=4.6e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0862)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY52 at UniProt or InterPro

Protein Sequence (673 amino acids)

>Psyr_0862 Acyltransferase 3 (Pseudomonas syringae pv. syringae B728a)
MGIPHNPALGYRPEIDGLRALAVIPVILFHAGMPLFSGGFVGVDIFFVISGYLITSIILA
EKIRGRFSLINFYERRARRILPALFVVMLICLPVAWLTLDPSDLKYFAKSLVAVPTFSSN
VLFWLESGYFDATAELKPLLHTWTLAVEEQYYLFFPLLLMLAWGLGRKRLIVLLMAVALA
SLALAQLGAHQDTSNAFYLLPARAWELLAGSFIAFYFAWRPRSIGRASAVDQAATLLGLL
LIGYAVIGFDSSTPFPGLNALVPVLGAVLIIVFAHGKTWVGRALSSRVPVAIGMLSYSAY
LWHQPVFAFARQYNLTEPGLPFMLALTLVSLVLAWLSWRFVEQPFRKAGTFNRGQIFTTA
GAASTFFVALGLLGYVNNGFPQRFAVDPELHQAFADPLIRDKCDQPLAGKGGKVDFCLFG
LADDQAAPEMALFGDSHSEALLSTFDAAARDQGRTLAHIGLGGCLPLLGVDVANGNYAAG
VCEALADREFDYVKRQRIKKVVLVARWTLYTGDDYSERTMSKYFLTSRADPQKSRETSRR
VFSQALEHTIEAYRSIGAEVFIVAQVPQQMINPESLYYRLARDASDSDEQALKRVSELSV
PMDKHDLLQRFTRQLFLRASQSKHISLITLDDAFCKDRQCLIGDLHSYYKDFNHLNARGA
GLLVGQISHILDQ