Protein Info for Psyr_0857 in Pseudomonas syringae pv. syringae B728a

Annotation: [SSU ribosomal protein S18P]-alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 14 to 144 (131 residues), 138.7 bits, see alignment E=6.3e-45 PF00583: Acetyltransf_1" amino acids 17 to 122 (106 residues), 48.9 bits, see alignment E=1.5e-16 PF13673: Acetyltransf_10" amino acids 40 to 128 (89 residues), 43.4 bits, see alignment E=6.8e-15 PF13508: Acetyltransf_7" amino acids 42 to 124 (83 residues), 45 bits, see alignment E=2.4e-15 PF08445: FR47" amino acids 66 to 125 (60 residues), 32.4 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 99% identity to psp:PSPPH_0888)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY57 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Psyr_0857 [SSU ribosomal protein S18P]-alanine acetyltransferase (Pseudomonas syringae pv. syringae B728a)
MSDAVTFRRMTEADMDAVLKIEYAAFSHPWTRGIFLDGLKSYEIWLMFEGAQQVGHGVLQ
VIIDEAHLLNITVKPENQGRGLGLLLLDHLMKRAYQLNARECFLELRDSNRPAYRLYENY
GFNEIGRRRDYYPAVGGREDAVVMACTLFE