Protein Info for Psyr_0850 in Pseudomonas syringae pv. syringae B728a

Annotation: Oxidoreductase, molybdopterin binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 155 to 169 (15 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 114 to 271 (158 residues), 115.4 bits, see alignment E=1.1e-37

Best Hits

Swiss-Prot: 95% identical to MSRP_PSESM: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K07147, (no description) (inferred from 100% identity to psb:Psyr_0850)

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY64 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psyr_0850 Oxidoreductase, molybdopterin binding protein (Pseudomonas syringae pv. syringae B728a)
MLIKLPSASDSKESDVTPESIYLSRRTLLASSLAGLAVTAMPRWAGAADASRYADVEPGK
APGWFAEKLPATKWQAVNVQDEAITPFKDATHYNNFYEFGTDKGDPAKNAGSLQTEPWSV
VIDGEVAKPGRYALEDFMKPYQLEERIYRLRCVEAWSMVIPWIGFPIAALLKQVEPTSKA
KYIRFETLEDAKSMPGQRSDFALIDWPYVEGLRLDEAMNPLAILAVGMYGRELPNQNGAP
LRLVVPWKYGFKSVKSIVRISLVSEQPKTTWQSIAANEYGFYANVNPTVDHPRWTQARER
RLPSGLFSPNLRDTKMFNGYEEEVGSLYAGMDLRKDY