Protein Info for Psyr_0849 in Pseudomonas syringae pv. syringae B728a

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 42 to 205 (164 residues), 72.7 bits, see alignment E=2.2e-24 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 48 to 224 (177 residues), 116.7 bits, see alignment E=5e-38

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 100% identity to psb:Psyr_0849)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.8

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY65 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Psyr_0849 CDP-diacylglycerol--serine O-phosphatidyltransferase (Pseudomonas syringae pv. syringae B728a)
MSERPEEPVKASDAESLLPIDEHVEEGHDAEGRQVRHRGIYLLPNLFTTANLFAGFYSII
SSMSAQSAMSAGDFAGASKYFAFAAIAIFVAMVLDGLDGRVARMTNTQSAFGAEYDSLSD
MVAFGVAPALLAFGWALGDMGKVGWMVAFIYVAGAALRLARFNTQVGKADKRYFIGLASP
AAAGVVAGTVWAFSDFGIQGSKLSFLVALLVAAAGMLMVSNIKYNSFKELDLKGRVPFVA
ILAVVLVFAVVFSDPPRILLLIFLAYALSGPIQYLLRRRKA