Protein Info for Psyr_0841 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 PF01636: APH" amino acids 166 to 328 (163 residues), 26.9 bits, see alignment E=4.1e-10 PF13671: AAA_33" amino acids 382 to 523 (142 residues), 143.8 bits, see alignment E=4.5e-46

Best Hits

KEGG orthology group: K07028, (no description) (inferred from 100% identity to psb:Psyr_0841)

Predicted SEED Role

"FIG00955330: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY73 at UniProt or InterPro

Protein Sequence (556 amino acids)

>Psyr_0841 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MGADYTHFTEDRQTPESAVCSLAPSGHNGGIVYLHFEHIPEGSTVSQSLIAALQNPALFP
HPVESFQVIETHISWVLLTGPYAYKFKKPMNFGFLDFTTLALRKHFCEEELRLNQRLTDD
LYIEVLPITGTEDTPQLGGDGEAIEYALKMKQFSQDGLLSTLQANGELTTAHIDELARQI
AGFHLTSPQVGAESELGSADSVMAPVVQNFEQIRPLISEKSDLAQLDALHAWAESSFARL
KPLLAHRKADGFIRECHGDIHLGNATVIDGKVVLFDCIEFNEPFRKTDVYADIGFLAMDL
EDRGLKSLSRRLISQYLEVTGDYAGLELLNFYKAYRAMVRAKVALFSQPADADGLQRAAT
LRQYRNYANLAESYSAIPSPFLTITHGVSAVGKSHVAMRLVESLGAIRLRSDVERKRLFA
GQGQDLYDAQASSTTYARLHELATATLRAGFSVVIDATYLKREQRDAAAKVAENTGVPFL
ILDCEAPQAVIAGWLAQRQAQDNDPSDATLEVIEAQQASREPLGADEILRSKKVATNVSS
DLDSLIDNLRQRMPGL