Protein Info for Psyr_0835 in Pseudomonas syringae pv. syringae B728a
Annotation: transcriptional regulator, TraR/DksA family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to DKSA_ECOL6: RNA polymerase-binding transcription factor DksA (dksA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K06204, DnaK suppressor protein (inferred from 100% identity to psb:Psyr_0835)Predicted SEED Role
"C4-type zinc finger protein, DksA/TraR family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZY79 at UniProt or InterPro
Protein Sequence (146 amino acids)
>Psyr_0835 transcriptional regulator, TraR/DksA family (Pseudomonas syringae pv. syringae B728a) MPTPEKQQNHLISGFEPYVPTKGEEYMGEPMRAHFTKILNKWKQDLMQEVDRTVDHMKDE AANFPDPADRASQEEEFSLELRARDRERKLIKKIDKTLQLIKDEEYGWCESCGVEIGIRR LEARPTADQCVDCKTLAEIKEKQVGK