Protein Info for Psyr_0834 in Pseudomonas syringae pv. syringae B728a

Annotation: Glutamyl-tRNA synthetase, class Ic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 14 to 34 (21 residues), see Phobius details TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 7 to 270 (264 residues), 363.7 bits, see alignment E=3e-113 PF00749: tRNA-synt_1c" amino acids 9 to 231 (223 residues), 149.2 bits, see alignment E=6.8e-48

Best Hits

Swiss-Prot: 100% identical to GLUQ_PSEU2: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 100% identity to psb:Psyr_0834)

MetaCyc: 50% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY80 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Psyr_0834 Glutamyl-tRNA synthetase, class Ic (Pseudomonas syringae pv. syringae B728a)
MKKPACIGRFAPTPSGYLHFGSLVAALASYLDARAADGQWLLRMEDLDPPREVAGAQAGI
LETLERYGFEWDGQMVRQSERHDAYAEILQRWFNHGLAYACTCSRKQLEGFQGIYPGFCR
NAGHSPDNAAIRIRVPELEYRFDDRVQGTFKMHLGRESGDFVIRRRDGLYAYQLAVVIDD
AWQGVTDIVRGADLLDSTPRQLYLQELLGLPQPRYLHVPLITQPDGHKLGKSYRSPPLPA
DQATPLLLRALRALGQPLDTHMADGTAQEVLAWGIRHWNADLIPRLRNIEEARID