Protein Info for Psyr_0807 in Pseudomonas syringae pv. syringae B728a

Annotation: HAD-superfamily hydrolase, subfamily IB (PSPase-like):HAD-superfamily subfamily IB hydrolase, hypothetical 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01490: HAD hydrolase, family IB
  • amino acids 29 to 217 (189 residues), 106.7 bits, E=1.9e-34
• TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB
  • amino acids 29 to 211 (183 residues), 87 bits, E=1.5e-28
• PF12710: HAD
  • amino acids 30 to 209 (180 residues), 96.2 bits, E=1.7e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0807)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

See Q4ZYA7 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Psyr_0807 HAD-superfamily hydrolase, subfamily IB (PSPase-like):HAD-superfamily subfamily IB hydrolase, hypothetical 2 (Pseudomonas syringae pv. syringae B728a)
MIEPDLQNAGPDLEPVGPDLEIEVEQRLLAVFDFDGTITRHDSFVPFLKFAFGQRAFSVR
MARLVLPSIGYLAKRLTRDELKGRLIKAFLSGVEVQWLQQKAEAFCQSHWKRLMRPAALE
SIAAEIEKGAIVTLCSASPAMVLQPFADRLKVELIGTNLEVIDGRLTGLIEGSNCRCDSK
VARLESVYGPLTQFRVRAWGDTRGDHELLAAAQDAHWRLFHPTWRRGRYKGPVNAKLHNP
DGKDGPTR