Protein Info for Psyr_0796 in Pseudomonas syringae pv. syringae B728a

Annotation: type 4 prepilin peptidase 1, Aspartic peptidase, MEROPS family A24A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 159 to 176 (18 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 220 to 247 (28 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details PF06750: A24_N_bact" amino acids 20 to 126 (107 residues), 114.6 bits, see alignment E=1.7e-37 PF01478: Peptidase_A24" amino acids 136 to 245 (110 residues), 98 bits, see alignment E=4.2e-32

Best Hits

Swiss-Prot: 78% identical to LEP4_PSEAE: Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 100% identity to psb:Psyr_0796)

MetaCyc: 78% identical to prepilin leader peptidase/N-methyltransferase (Pseudomonas aeruginosa)
Prepilin peptidase. [EC: 3.4.23.43]; 2.1.1.- [EC: 3.4.23.43]

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYB8 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Psyr_0796 type 4 prepilin peptidase 1, Aspartic peptidase, MEROPS family A24A (Pseudomonas syringae pv. syringae B728a)
MPLLDLLASSPLAFVTTCCILGLIIGSFLNVIVYRLPIMMERDWKAQSRELLGLPAEPDQ
PVFNLNRPRSSCPHCAHKIRPWENLPVISYLLLRGKCSQCKAPISKRYPLVELTCAVLSA
YVAWHFGFGWQATAMLVLGWGLLAMSLIDADHQLLPDSLVLPLLWLGLIVNAFGLFTSLN
DALWGAVAGYLALWSVFWLFKLVTGKEGMGYGDFKLLAMLGAWGGWQVLPLTILLSSLVG
AVLGVIMMRVRRVESGTPIPFGPYLAIAGWIALLWGGQITDSYMQFAGFR