Protein Info for Psyr_0777 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00356: LacI" amino acids 6 to 51 (46 residues), 37.8 bits, see alignment 3.3e-13 PF00532: Peripla_BP_1" amino acids 63 to 325 (263 residues), 92.6 bits, see alignment E=8e-30 PF13407: Peripla_BP_4" amino acids 65 to 312 (248 residues), 47.9 bits, see alignment E=3.5e-16 PF13377: Peripla_BP_3" amino acids 171 to 332 (162 residues), 105 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to psb:Psyr_0777)

Predicted SEED Role

"FIG00957008: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYD7 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psyr_0777 transcriptional regulator, LacI family (Pseudomonas syringae pv. syringae B728a)
MTRPVTLKDVANHAGLSKAAVSRYLNRSISLPPETAQRIDLAIKALDYRGNSLARRLSKG
GSETIGLVLPDIANPFFAELADAAEEEASAHGYNLVLCVTRNLLERESTFVRWLDSRNVD
GLLLVSNRPDDGTLASQLMSYRNIILLDEDVPGTSQPKVFADNHQGGRLATDYLIRHGHR
RIAHVSGPSALMSARERYAGYREALALASIAEVPEYLCFGDYSREFGRIATAQLLTLPDP
PEAIFAASDFIALGVLDVLRERTISVPGAMSLVGFDDAVYASLLTPPLCTIRQSSRELGR
LGVAQLLQRMTGGDCAQDIVRVPVELVCRGTVATRSD