Protein Info for Psyr_0774 in Pseudomonas syringae pv. syringae B728a

Annotation: monosaccharide ABC transporter membrane protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 265 to 293 (29 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 320 (268 residues), 117.1 bits, see alignment E=4.2e-38

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to psb:Psyr_0774)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYE0 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Psyr_0774 monosaccharide ABC transporter membrane protein, CUT2 family (Pseudomonas syringae pv. syringae B728a)
MKTLDLTRQRILPQSLFKRLLHDFPGVVSIGLFFALCFVLFALVTDNFLSGANLLNVIRQ
NAPLLIVAVAMTLVVTTGGIDLSVGSTLALVGALAAMALNAWHLPWPLVLLGGLAVGAMI
GALNGYFIAYAGIPAFIVTLATLTIIRGLAMLLTQGYSIPVPREEAAFLALGRGWFLGVP
LTAWLALLVTLGGVLVLGKMRFGRYLTGIGANAESVRRAGVNHRGVLLRVYMLSGMAAAL
AGMIVTARLGSGSSNQGEGFELEVIAAVVLGSTSLFGGFGTIVGTLLGVLTMAAIKNGLI
LAHVSPFYTQIATGLIVLLAIWLNTRILRTGRPLGRAGA