Protein Info for Psyr_0763 in Pseudomonas syringae pv. syringae B728a

Annotation: Porin, LamB type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02264: LamB" amino acids 115 to 525 (411 residues), 314.5 bits, see alignment E=9.6e-98

Best Hits

KEGG orthology group: K02024, maltoporin (inferred from 100% identity to psb:Psyr_0763)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYF1 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Psyr_0763 Porin, LamB type (Pseudomonas syringae pv. syringae B728a)
MQNASRWLLAGVLGTSTTVSQAATLEERMAAFEARASAAEKRAAAAEQQTQALARELQQL
KLATPAAQPAAPTSAPTVAASPQPALDDRVAKLEARQQSMEKPGGVGHLTDGFSFKGYAR
SGLLINDGLGGGRGGPYTTPAGSVGGAVGRLGNEDDTYMRFDLSKEIYAQNGTRSKFTVS
IADGVESYNDWTPTESSLNVRQVFTELDHIAAFKGNSVFENSTLWAGKRFDRDNFDIHWL
DSDVVFLAGTGGGIYDVQMTRDWRSNYSLIGRNYGDFSEGGVDADVESYILTSNQFFDNG
QWQWMFNAIGARKNDVGTRTNQAGFAPADSGLHTMLANHQKDFFGREGFFKTALLYGQGL
GAQVKDIGADGELLDDARAVRLAMYGETPIAPGWRIGPSLLAEQSKDRYVKGDDYRWLTL
NMRLANEINSNFEMAYELSWQTMDLDPKGYLQRNAVDGNFWKFTVAPTFKPDMGDLLTRP
ELRVFASLMNWSSDLDRYSTTGNFGKSDFNSGGVWQLGIQMETWF