Protein Info for Psyr_0759 in Pseudomonas syringae pv. syringae B728a

Annotation: carbohydrate ABC transporter ATP-binding protein, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00005: ABC_tran" amino acids 18 to 160 (143 residues), 116.2 bits, see alignment E=4.7e-37 PF17912: OB_MalK" amino acids 234 to 286 (53 residues), 32.5 bits, see alignment 3.2e-11 PF08402: TOBE_2" amino acids 279 to 349 (71 residues), 59.9 bits, see alignment E=5.5e-20 PF03459: TOBE" amino acids 292 to 348 (57 residues), 27.9 bits, see alignment E=5.4e-10

Best Hits

Swiss-Prot: 59% identical to MALK_YERPA: Maltose/maltodextrin import ATP-binding protein MalK (malK) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K10111, maltose/maltodextrin transport system ATP-binding protein [EC: 3.6.3.19] (inferred from 100% identity to psb:Psyr_0759)

MetaCyc: 53% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)" in subsystem Maltose and Maltodextrin Utilization (EC 3.6.3.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.19 or 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYF5 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psyr_0759 carbohydrate ABC transporter ATP-binding protein, CUT1 family (Pseudomonas syringae pv. syringae B728a)
MKLKLDNINKQLGGTRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICAGDLL
IDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTEKSSLRERVLKTAQIL
QLDKLLQRKPRELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHK
RLGSTMIYVTHDQVEAMTLADKIVVLNGGQVEQVGSPRELYERPASLFVAGFLGSPRMNF
LPVSLQAPGRSSLIDIPALGMKSLPFDSSNLTEDAQLTLGVRPEHITLNAANNGVGVTVS
GVEYLGSEVYVHLATGASEPLICRCDAKAGWQVGDQVALQFDDSNLHLFDADGLALKRHT
DASQHLTPGTTPHLVQAGTL